PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G283200.1
Common NamePHAVU_002G283200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family BBR-BPC
Protein Properties Length: 313aa    MW: 35267.2 Da    PI: 10.1612
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G283200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind329.11.2e-10023122301
           GAGA_bind   2 dddgsre..rnkg.yye..............pa.aslkenlglqlmssiaerdaki..rernlalsekkaavaerdmaflqrdkalaernk 72 
                         +d  ++e  r+k  yy+              ++ ++l   +++++ s++aer+a+i   e ++a+s k++a+a+rd a  qrd+ala+r++
  Phvul.002G283200.1   2 EDGRQNEndRHKMeYYRgahsmwntdsqhqvKEpNALV--MNKKIRSIMAERQAAIleLELEAAISVKNEALAARDAAIRQRDEALAQRDN 90 
                         55544444599988999999999999877663335666..99**************77677889*************************** PP

           GAGA_bind  73 alverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekk 163
                         a++erdn+l+al+ ++ns   + p+g+++  g+k ++++ + + p++++ ++++++ + l + p e    ++ ++k++k+++  +++ ++ 
  Phvul.002G283200.1  91 AILERDNALAALQSRNNS--VSFPFGSRIQCGSKRMHHSSN-HLPNMSEASYKTKDASPLAVIPFEA--VKSPQAKRTKENKVISSKASNP 176
                         **************9998..77899************8887.77*********99999999999765..4445555555567777777888 PP

           GAGA_bind 164 akkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaR 254
                           k+kk +e+ ++k + e+  ++ ++e+  +d++ln v++De+t+PvPvC+CtG++rqCYkWGnGGWqS+CCttt+S++PLP+ +++r+aR
  Phvul.002G283200.1 177 PYKVKKMGEDLNRKASFEG--TKIRSEWHRQDVGLNLVTFDETTMPVPVCTCTGIPRQCYKWGNGGWQSSCCTTTLSMHPLPQLPNKRHAR 265
                         8899999999999999988..57******************************************************************** PP

           GAGA_bind 255 iagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         i+grKmS+++f++lL++L  eG+dls p+DLk++WA+HGtn+++ti+
  Phvul.002G283200.1 266 IGGRKMSGSVFTRLLSRLVLEGHDLSIPLDLKEYWARHGTNRYITIK 312
                         **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012268.4E-1271312IPR010409GAGA-binding transcriptional activator
PfamPF062173.1E-9213312IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MEDGRQNEND RHKMEYYRGA HSMWNTDSQH QVKEPNALVM NKKIRSIMAE RQAAILELEL  60
EAAISVKNEA LAARDAAIRQ RDEALAQRDN AILERDNALA ALQSRNNSVS FPFGSRIQCG  120
SKRMHHSSNH LPNMSEASYK TKDASPLAVI PFEAVKSPQA KRTKENKVIS SKASNPPYKV  180
KKMGEDLNRK ASFEGTKIRS EWHRQDVGLN LVTFDETTMP VPVCTCTGIP RQCYKWGNGG  240
WQSSCCTTTL SMHPLPQLPN KRHARIGGRK MSGSVFTRLL SRLVLEGHDL SIPLDLKEYW  300
ARHGTNRYIT IK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159983.10.0hypothetical protein PHAVU_002G283200g
RefseqXP_007159984.10.0hypothetical protein PHAVU_002G283200g
SwissprotQ8S8C61e-124BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLV7CRJ40.0V7CRJ4_PHAVU; Uncharacterized protein
STRINGGLYMA05G38430.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69743348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-121basic pentacysteine 4